DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP005065

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_313940.4 Gene:AgaP_AGAP005065 / 1274748 VectorBaseID:AGAP005065 Length:246 Species:Anopheles gambiae


Alignment Length:249 Identity:77/249 - (30%)
Similarity:115/249 - (46%) Gaps:19/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAA 70
            :::..|..|..|||   |...:..|||||.....:..|:||:|...||..|||||.....::|||
Mosquito     7 VVVGLVLVAFLGTV---LSVPIWNRIVGGQLAEDTQMPYQIALFYQGSFRCGGSIIGDRHVLTAA 68

  Fly    71 HCLQS----VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131
            ||:..    :.|....:.|||::.::||..|.|.:...||||  ....:|||::::.....|...
Mosquito    69 HCVMDDDVLLPAFKFGVHAGSAHLNAGGKLFKVRAVYPHEGY--GNFQHDIAVMEMKEPFAFDKY 131

  Fly   132 IKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMI 196
            |:.|.|.......|....:||:|.:.......|: |.|.::.:|....|.|.:.|        ::
Mosquito   132 IQPIELMDEEVPLGGEVVISGYGRVGSNGPVSPA-LLYTSMFVVEDENCNSISEG--------LM 187

  Fly   197 CAAASGK-DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |....|. .||.||||||.|..|.|.||.::.......|:...||.|:....|:
Mosquito   188 CIDKEGSYGACNGDSGGPAVYDGKLAGVANFIIDQCGGNFADGYAKVSFYLDWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 70/223 (31%)
AgaP_AGAP005065XP_313940.4 Tryp_SPc 28..241 CDD:214473 70/223 (31%)
Tryp_SPc 29..243 CDD:238113 70/224 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.