DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP004566

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_313869.5 Gene:AgaP_AGAP004566 / 1274708 VectorBaseID:AGAP004566 Length:327 Species:Anopheles gambiae


Alignment Length:279 Identity:96/279 - (34%)
Similarity:139/279 - (49%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTVPEGLLPQLDG-------------RIVGGSATTISSFPWQISLQRSGSHS 55
            |:..|:.:..:.....||.|.|. |.             |||||..|.::.:||...||.||:..
Mosquito    44 FIEWLAGLIGSTSTPAPENLTPP-DSCPMCKCGRTNRLTRIVGGQETQVNQYPWMAMLQYSGTFY 107

  Fly    56 CGGSIYSSNVIVTAAHCLQSVSASVLQI------RAGSSYWSSGGVTFSVSSFKNHEGYNANTMV 114
            ||||:.|...::|||||:...:.:.:.:      |..:|  .|..:...|.....|.|||:|...
Mosquito   108 CGGSLISDRHVLTAAHCVHGFNRNKISVVLMEHDRVSTS--ESMTMVSKVLRVIEHNGYNSNNYN 170

  Fly   115 NDIAIIKINGALTFSSTIKAIGLAS-SNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQS 178
            :||||:::...:|....::.:.|.: ..|..|....|:|||..| .:.:|.:.||.|.|.|:|.:
Mosquito   171 SDIAILRLATVMTIEDKLRPVCLPTPKKPFTGYDGIVTGWGATS-ENGAISTNLQEVTVPIMSNA 234

  Fly   179 QCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPL------VSGGV--LVGVVSWGYGCAYS 233
            .|..:.|| .|:|...|:||.  ...||:|||||||||      .:..|  :.|:||||.|||..
Mosquito   235 DCRKTGYG-ASRITDNMLCAGYDEGKKDSCQGDSGGPLHVIKQNSTDNVHQIAGIVSWGEGCAKP 298

  Fly   234 NYPGVYADVAALRSWVISN 252
            ||||||..|....:|:.||
Mosquito   299 NYPGVYTRVNRFGTWIRSN 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 86/235 (37%)
AgaP_AGAP004566XP_313869.5 Tryp_SPc 82..314 CDD:214473 86/235 (37%)
Tryp_SPc 83..317 CDD:238113 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.