DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP004552

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_313850.5 Gene:AgaP_AGAP004552 / 1274693 VectorBaseID:AGAP004552 Length:349 Species:Anopheles gambiae


Alignment Length:251 Identity:84/251 - (33%)
Similarity:118/251 - (47%) Gaps:19/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVS 77
            |..|...|      ::.|||||.....:||.|..:|.......||||:.|...::|||||.....
Mosquito    99 CKCGSVEP------INERIVGGIPVEDNSFSWMAALYYDNKFCCGGSLLSDRYVITAAHCTTKPD 157

  Fly    78 ASVLQIRAGSSYWSSGGVTFSVSSFKN--HEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASS 140
            ..:.:::.|.:..|....|....|.|.  ...|||....||||::::...:..|..:..|.|..:
Mosquito   158 RGLFRVQFGINDRSKPIATSIERSVKRILTNWYNAFNNNNDIALLELTYPVAISDRVMPICLPQA 222

  Fly   141 NPA-NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASG 202
            ... .|:...|:|||....| ..:...|....|.|::..:|..:.| :..||.:.|:||.  ..|
Mosquito   223 TEMYEGSRGIVTGWGRTKAG-GGLSGTLMQTEVPILTNRECRRAGY-WAFQITNKMLCAGYLEGG 285

  Fly   203 KDACQGDSGGPL------VSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISN 252
            ||:|||||||||      .:...||||||||..||..|:|||||.|:....|:..|
Mosquito   286 KDSCQGDSGGPLQVLNTKSNHYELVGVVSWGRACAQKNFPGVYARVSQYLYWINRN 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 79/229 (34%)
AgaP_AGAP004552XP_313850.5 Tryp_SPc 110..338 CDD:214473 79/229 (34%)
Tryp_SPc 111..341 CDD:238113 79/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.