DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP004149

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_313033.3 Gene:AgaP_AGAP004149 / 1273976 VectorBaseID:AGAP004149 Length:543 Species:Anopheles gambiae


Alignment Length:285 Identity:83/285 - (29%)
Similarity:134/285 - (47%) Gaps:51/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISL----QRSG--SHSCGGSIYSSNV 65
            :::|..|.|          .::.||:||.......|||...|    |.||  ::.|.||:.::..
Mosquito   268 MINAPLCGL----------SVNTRIIGGETEVPGQFPWMARLAYRNQTSGRVTYRCAGSLITNRH 322

  Fly    66 IVTAAHCLQSV--SASVLQIRAGSSYWSSGGVT----------FSVSSFKNHEGYNANTMVNDIA 118
            ::|.|||:.::  ...::.||.|.  .....||          |::.....||.|:.....||||
Mosquito   323 VITVAHCVTNLIDELQLVSIRLGD--LECNAVTDPRCSARYQDFAIEQIIPHESYDVPKYANDIA 385

  Fly   119 IIKINGALTFSSTIKAIGLASSNPA------NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQ 177
            :||:.......:.|..:.|.:...|      .|....::|||:.|..|::....||::.:.||..
Mosquito   386 LIKLRETTETYNIISPLCLPTDQYAPYALNLTGQLGIIAGWGSTSNRSNTPSPTLQWLRLPIVDT 450

  Fly   178 SQCASSTYGYGSQIRSTMI------CA-AASGKDACQGDSGGPLVSGG-------VLVGVVSWG- 227
            :.||::...|....|:.:|      || ....:|||||||||||::..       ||:|:||:| 
Mosquito   451 AGCANAYARYSVNSRNPIIVSGNQMCAQGQENRDACQGDSGGPLMNEAISTRDRFVLLGLVSFGP 515

  Fly   228 YGCAYSNYPGVYADVAALRSWVISN 252
            ..|..||:||||..::|...|:::|
Mosquito   516 RTCGVSNFPGVYTRISAYIDWILAN 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 78/257 (30%)
AgaP_AGAP004149XP_313033.3 CLIP 47..92 CDD:288855
Tryp_SPc 281..537 CDD:214473 78/257 (30%)
Tryp_SPc 282..537 CDD:238113 77/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.