DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CLIPB5

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_313032.4 Gene:CLIPB5 / 1273975 VectorBaseID:AGAP004148 Length:379 Species:Anopheles gambiae


Alignment Length:301 Identity:83/301 - (27%)
Similarity:127/301 - (42%) Gaps:74/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VACALGGTVP----EGLLP-------QLDGRIVGGSATTISSFPWQISLQRS------GSHSCGG 58
            |.||.....|    .||||       |...||.||..|.|..|||...|:.:      |.| |||
Mosquito    85 VCCADSLVAPVRVGVGLLPSPGQCGIQTSDRIFGGVNTRIDEFPWIALLKYAKPNNVFGFH-CGG 148

  Fly    59 SIYSSNVIVTAAHCLQSVSA----SVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANT------- 112
            .:.:...::||:||:.....    ::.::|.|.  |.:       |:.::.||...:.       
Mosquito   149 VLINDRYVLTASHCVNGKDIPSTWNLAEVRLGE--WDT-------STAQDCEGLGDDVDCSPPPI 204

  Fly   113 -------------------MVNDIAIIKINGALTFSSTIKAIGL-----ASSNPANGAAASVSGW 153
                               ..||||::::..::.:|..||.|.|     ..:....|....|:||
Mosquito   205 DVPIEGKIPHPEYVPTSAEQYNDIALLRLQQSVPYSDFIKPICLPMQAELKARDYVGFRMQVAGW 269

  Fly   154 GTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA-SGKDACQGDSGGPL--- 214
            |..:  ::...:..|.|.|:.||...|..........:|.:.:||.. :|||:|||||||||   
Mosquito   270 GRTA--TARFSNVKQKVAVDGVSLDACNQVYQREQVLLRQSQLCAGGEAGKDSCQGDSGGPLTGV 332

  Fly   215 -VSGGV----LVGVVSWG-YGCAYSNYPGVYADVAALRSWV 249
             .:||:    |:|:||:| ..|..:.:||||..|.....|:
Mosquito   333 HTAGGLQYWYLIGLVSFGPTPCGQAGWPGVYTKVDQYVDWI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/269 (27%)
CLIPB5XP_313032.4 CLIP 33..87 CDD:288855 1/1 (100%)
Tryp_SPc 115..373 CDD:214473 73/269 (27%)
Tryp_SPc 116..373 CDD:238113 72/268 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.