DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP003248

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_312959.4 Gene:AgaP_AGAP003248 / 1273921 VectorBaseID:AGAP003248 Length:296 Species:Anopheles gambiae


Alignment Length:271 Identity:72/271 - (26%)
Similarity:112/271 - (41%) Gaps:51/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ-----RSGSHSCGGSIYSSNVIVTAAHCLQS 75
            |...||.|:..|        ...:...||...::     .|.|:.||||:.:...:||||||:.|
Mosquito    41 GNDAPERLITSL--------VAQLDEAPWMALIEYWKPNGSLSYLCGGSLINERYVVTAAHCVTS 97

  Fly    76 VSA--SVLQIRAGS-----------SYWSSGGVTFSVSSFKNHEGYN--ANTMVNDIAIIKINGA 125
            :..  :|.:||.|.           |..:...:..:|.....||.|.  :....||||:|:::..
Mosquito    98 LPQGWTVHRIRLGEWDLSTSEDCDHSRCNDAPIDVAVDKITVHEDYKSPSRNHRNDIALIRLDRQ 162

  Fly   126 LTFSSTIKAIGLASSNPANGAAASVS-------GWGTLSYGSSSIPSQLQYVNVNIVSQSQCASS 183
            :.::.|:..|.|    |.||...:..       ||...::|  .|..:...|..::|....|:|:
Mosquito   163 MHYTETVAPICL----PQNGPLQTQRYRTMHSVGWIEENFG--PIGGKKLQVEQDLVDFQNCSSN 221

  Fly   184 TYGYGSQIRSTMICAAASGKDACQGDSGGPL---VSG-GVLVGVVSWG---YGCAYSNYPGVYAD 241
            .......:..|.:|.|.. ||.....:||||   ::| ..|.||.|:|   ||..  ..|.||.:
Mosquito   222 YLQASIALADTQLCVAQQ-KDNRIDIAGGPLMQRIAGHWYLFGVASFGGRNYGTV--ELPNVYTN 283

  Fly   242 VAALRSWVISN 252
            |.....|:.||
Mosquito   284 VMEYVDWIESN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 64/252 (25%)
AgaP_AGAP003248XP_312959.4 Tryp_SPc 53..291 CDD:214473 64/246 (26%)
Tryp_SPc 54..294 CDD:238113 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.