DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CLIPB10

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_312744.4 Gene:CLIPB10 / 1273735 VectorBaseID:AGAP003058 Length:362 Species:Anopheles gambiae


Alignment Length:305 Identity:77/305 - (25%)
Similarity:128/305 - (41%) Gaps:81/305 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VACALGGT--------VPEGL---------LPQLDGRIVGGSATTISSFPWQISLQ---RSGSHS 55
            :.|..|.|        |.:||         |..|..||:||:.|.|..|||...|:   :.|..:
Mosquito    73 ICCPDGVTTVDRNPTAVRDGLPNPKAFECGLDTLADRIIGGNYTAIDEFPWYALLEYQSKKGERA 137

  Fly    56 --CGGSIYSSNVIVTAAHCLQSVSAS----VLQIRAGSSYWSSGGVT----------------FS 98
              ||||:.:...::||||||.:....    ::.:|.|.  :::...|                |.
Mosquito   138 FKCGGSLINGRYVLTAAHCLANKKLDEGERLVNVRLGE--YNTATDTDCADGNPDDCADPPQNFG 200

  Fly    99 VSSFKNHEGYNAN--TMVNDIAIIKINGALTFSSTIKAIGLASSN--PAN-GAAASVSGWG-TLS 157
            :.:...|.||:.|  ...:|||:|:::..:|.::.:..:.|...:  |.: |...:..|:| |..
Mosquito   201 IEAQIVHPGYDKNGPYQHHDIALIRLDRDVTMNNFVSPVCLPPDDFPPTSPGLNVTAVGFGHTGR 265

  Fly   158 YGSSSIPSQLQY------------VNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDS 210
            ...|.|..:.|:            .|:.::.:..||...:|.                |:|.|||
Mosquito   266 QRHSGIKKKAQFPVFAQEECDKKWKNIEVIGEQLCAGGVFGI----------------DSCSGDS 314

  Fly   211 GGPLVSG---GVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISN 252
            ||||:..   .:..||:|:|..||...:||||..|::...|:..|
Mosquito   315 GGPLMVKRFYWIQEGVISFGNQCALEGWPGVYTRVSSYLDWIRQN 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 67/264 (25%)
CLIPB10XP_312744.4 CLIP 23..76 CDD:197829 0/2 (0%)
Tryp_SPc 109..356 CDD:214473 67/264 (25%)
Tryp_SPc 110..359 CDD:238113 67/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.