DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CLIPD1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_312523.4 Gene:CLIPD1 / 1273538 VectorBaseID:AGAP002422 Length:435 Species:Anopheles gambiae


Alignment Length:250 Identity:82/250 - (32%)
Similarity:128/250 - (51%) Gaps:20/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PE----GLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASV 80
            ||    ||..:...:|.||.....:.:||.::|..|.:..|||.:.:...::|||||:.::..:.
Mosquito   188 PEERGCGLSTKQLSKIAGGRPADSNEWPWMVALVSSRASFCGGVLITDRHVLTAAHCVMNLKLTQ 252

  Fly    81 LQIRAGSSYWSSGGVT----FSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN 141
            ..:|.|...:.....|    |.|:..:.|..::..:..||||::|:.....|:|.|..|.:...:
Mosquito   253 FVVRLGEYDFKQFNETRYRDFRVAEIRAHADFDQISYENDIAMLKLIQPSFFNSYIWPICMPPLD 317

  Fly   142 PA-NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA--SGK 203
            .| .|..|.|:||||..:|....| .|..|.:.|.|..:|...   |.::|.:|.:||..  .||
Mosquito   318 DAWTGYQAVVTGWGTQFFGGPHSP-VLMEVRIPIWSNQECQEV---YVNRIYNTTLCAGEYDGGK 378

  Fly   204 DACQGDSGGPLV-----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISNA 253
            |:|||||||||:     ....:||:||||..|..:|:||:|..|::...|:|.||
Mosquito   379 DSCQGDSGGPLMIQLPNRRWAVVGIVSWGIRCGEANHPGIYTRVSSYVRWIIENA 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/230 (32%)
CLIPD1XP_312523.4 CLIP 102..147 CDD:197829
Tryp_SPc 202..429 CDD:214473 74/230 (32%)
Tryp_SPc 203..432 CDD:238113 76/232 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.