DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CLIPD6

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_312099.2 Gene:CLIPD6 / 1273147 VectorBaseID:AGAP002813 Length:484 Species:Anopheles gambiae


Alignment Length:249 Identity:76/249 - (30%)
Similarity:116/249 - (46%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSG-----SHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSY 89
            |:|||....::.:||...:....     |..||||:.:...::|||||::...:||   |.|...
Mosquito   232 RVVGGVPAELNGWPWMALVGYKNTLGEVSFKCGGSLITKRHVLTAAHCIRRDLSSV---RLGEHD 293

  Fly    90 WSSGGVT----FSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPAN-----G 145
            .|:...|    ..|..:::|..|:......|:|::.:...:.||..||.|.|..|....     |
Mosquito   294 TSTDAETKHIDVPVVRYESHPSYDKKDGHTDLAVLYMEFEVQFSDAIKPICLPLSETIRSKNFIG 358

  Fly   146 AAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYG-----SQIRSTMICAAA--SGK 203
            ....|:|||....|..| .:.||.:.:.|::..:|.:.....|     .|..:.::||..  .||
Mosquito   359 YTPFVAGWGRTQEGGKS-ANVLQELQIPIIANDECRTLYDKIGKVFSQKQFDNAVMCAGVIEGGK 422

  Fly   204 DACQGDSGGPLVSGG--------VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |:|||||||||:...        ..||:||:|.|||.:..||||..||:...|:
Mosquito   423 DSCQGDSGGPLMLPQRFGTEFYYYQVGIVSYGIGCARAEVPGVYTRVASFVDWI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/247 (30%)
CLIPD6XP_312099.2 CLIP 25..80 CDD:288855
CLIP 114..166 CDD:288855
Tryp_SPc 232..476 CDD:214473 75/247 (30%)
Tryp_SPc 233..479 CDD:238113 75/248 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.