DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP010661

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_311381.4 Gene:AgaP_AGAP010661 / 1272469 VectorBaseID:AGAP010661 Length:175 Species:Anopheles gambiae


Alignment Length:177 Identity:56/177 - (31%)
Similarity:85/177 - (48%) Gaps:8/177 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANG 145
            :.:..||:..:.|||.|..|....|..||..|...|.||::|..:......|..|.|..:...:.
Mosquito     1 ITLHGGSTTQTRGGVIFQASKIVIHPYYNPETHDYDAAIVEIKTSFQGYDNIAPIALQDAEVPSD 65

  Fly   146 AAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGK-DACQGD 209
            .....:|||..:|...:.|..|||..:.:::|.||:::   :||.....:|||..:.. |.|:||
Mosquito    66 TTCYAAGWGLNNYDRRTTPDNLQYATLQVITQQQCSAA---WGSYATPQVICAQQNNNGDVCKGD 127

  Fly   210 SGGPLVSGGVLVGVVSW-GYGCAYSNYPGVYADVA--ALRSWVISNA 253
            ||||.|..|.|.|..|: |.||. ...|..:|.|.  |:|.::.:.|
Mosquito   128 SGGPFVCNGKLTGATSYGGIGCR-GRLPSAFAKVTAPAIREFIRNTA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 55/171 (32%)
AgaP_AGAP010661XP_311381.4 Tryp_SPc <1..172 CDD:238113 55/174 (32%)
Tryp_SPc <1..162 CDD:214473 53/164 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.