DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP010659

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_311380.4 Gene:AgaP_AGAP010659 / 1272466 VectorBaseID:AGAP010659 Length:393 Species:Anopheles gambiae


Alignment Length:215 Identity:66/215 - (30%)
Similarity:100/215 - (46%) Gaps:5/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL-QSVSASVLQIRAGSSYWSSG 93
            |||.|....|:|:|:.:.|:.:.:..||.||.:...:.|||||| ::.:.:.:.:..||:..:||
Mosquito     8 RIVNGKNANIASYPYIVRLRVNSAGVCGASIITYTHVFTAAHCLYKNQNPASITLYGGSTSQTSG 72

  Fly    94 GVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSY 158
            ||.|..|....|..||..|...|..|::|..:......|..|.|......:......:|||..:|
Mosquito    73 GVVFFASKVIIHPYYNPETHNYDAGIVQIKNSFQGYKNIAPIALQDVEVPSDTTCYAAGWGYNNY 137

  Fly   159 GSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGK-DACQGDSGGPLVSGGVLVG 222
            ...:.|..|||..:.::|..||::   |:.|......|||..:.. |.|.||||||.|....|.|
Mosquito   138 DRKTSPDNLQYATLQVISPQQCSA---GWSSYATPQFICAQQNNNGDVCNGDSGGPFVCNDKLTG 199

  Fly   223 VVSWGYGCAYSNYPGVYADV 242
            ..|:|........|..:..:
Mosquito   200 ATSYGGVACRGKLPSAFTKI 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 66/215 (31%)
AgaP_AGAP010659XP_311380.4 Tryp_SPc 8..222 CDD:214473 66/215 (31%)
Tryp_SPc 9..222 CDD:238113 65/214 (30%)
Trypsin <239..379 CDD:278516
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.