DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CLIPC10

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_310506.4 Gene:CLIPC10 / 1271650 VectorBaseID:AGAP000572 Length:380 Species:Anopheles gambiae


Alignment Length:300 Identity:88/300 - (29%)
Similarity:127/300 - (42%) Gaps:64/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAVACAL-------GGTV------------PEGLLPQLDGRIVGGSATTISSFPWQISL----- 48
            |..|.|.:       ||||            |.|  ..|...|..|.|.....||:..:|     
Mosquito    83 LPIVCCPVRLEPRLQGGTVAKRISVRQCEQFPNG--TGLADHIFNGVAAQFGEFPYMAALGYGAP 145

  Fly    49 --QRSGSHS---CGGSIYSSNVIVTAAHCLQS----VSASVLQIRAGSSYWSSGGVTFSVSSFKN 104
              ..:|..|   ||.|:.||..::||||||:.    ....||:::...:.  ...:..::.....
Mosquito   146 NGTEAGLPSLFRCGASLISSRFLLTAAHCLRERPVFARLGVLELQPARTV--DEPLDIAIRQATP 208

  Fly   105 HEGYNANTMVNDIAIIK----INGALTFSSTIKAIGLASSNPANGAAA------SVSGWGTLSYG 159
            |..|:|.|..||||:::    :.|...|   ::.:.|.::....|..|      ||.||||...|
Mosquito   209 HPDYHAVTYQNDIALLELAEPVTGDWPF---VEPVCLYTNATGGGLEALAGQPLSVQGWGTQQPG 270

  Fly   160 SSSIPSQLQYVNVNIVSQSQCASS---TYGYGSQIRSTMICAAASGK------DACQGDSGGPL- 214
            .:...::|...||::|.:..||:|   |....:.:....:||....:      |.|.||||||| 
Mosquito   271 DTEPAARLMKANVSLVERDACAASIPRTRRNPTGLHPGQLCALGRNEQNETVADTCPGDSGGPLA 335

  Fly   215 --VSG-GVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
              |.| ..|||:.|.||.|. |..||:|.:||....||.|
Mosquito   336 LNVDGRHYLVGITSSGYSCG-SPIPGIYTEVARYLDWVES 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/255 (29%)
CLIPC10XP_310506.4 CLIP 45..89 CDD:197829 2/5 (40%)
Tryp_SPc 122..372 CDD:214473 75/255 (29%)
Tryp_SPc 123..375 CDD:238113 77/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.