DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP011325

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_309327.4 Gene:AgaP_AGAP011325 / 1270612 VectorBaseID:AGAP011325 Length:631 Species:Anopheles gambiae


Alignment Length:270 Identity:72/270 - (26%)
Similarity:107/270 - (39%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSG-SHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSS 88
            |.::.:|..|....:..:||...||.:. :..|||::.:...::|||||.:. ..|.:.:|.|..
Mosquito   379 PYIEEKIANGIDAILFQYPWMALLQDTELAFVCGGTLINKRYVLTAAHCFRE-KLSKISVRLGEF 442

  Fly    89 YWSSG-------------GVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASS 140
            ...|.             ....:|.....|:.|:|...|||||:|::....:::..:..|.|..|
Mosquito   443 DLKSDIDCDKRGERCALPPQDIAVERTIKHKDYSARHKVNDIALIRLASEASYNENVMPICLPVS 507

  Fly   141 NPANGAAAS---VSGWGTLSYGSSS----------IPSQL---------QYVNVNIVSQSQCASS 183
             |.......   |||||.....:||          :|:.:         :||.||  |...||  
Mosquito   508 -PEMRTVKEIYYVSGWGLTENDTSSDVLQVGLLRQLPNDVCQQLLQRKDKYVTVN--SDQMCA-- 567

  Fly   184 TYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGG-----VLVGVVSWGY-GCAYSNYPGVYADV 242
                          ..|:..|.|.|||||||.:..     |..||||:|. .|.....||||..|
Mosquito   568 --------------IGANRTDNCSGDSGGPLKTVAVNARFVQYGVVSYGLRTCGKETAPGVYTRV 618

  Fly   243 AALRSWVISN 252
            .....|::.|
Mosquito   619 ENYIDWILDN 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 69/260 (27%)
AgaP_AGAP011325XP_309327.4 Tryp_SPc 44..287 CDD:238113
Tryp_SPc 46..286 CDD:214473
Tryp_SPc 384..625 CDD:214473 69/260 (27%)
Tryp_SPc 385..625 CDD:238113 69/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.