DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP006869

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_308888.1 Gene:AgaP_AGAP006869 / 1270209 VectorBaseID:AGAP006869 Length:272 Species:Anopheles gambiae


Alignment Length:269 Identity:99/269 - (36%)
Similarity:149/269 - (55%) Gaps:24/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGG----------TVPEGLL----PQLDGRIVGGSATTISSFPWQISLQRSGSH 54
            ||:.| .:..:|.|          .:|.||:    |...||||||....|:.||:|:||:::|:|
Mosquito     7 FVVAL-LIGSSLAGWEEDLYQSKRRLPSGLVLPIAPPTSGRIVGGFEANIADFPYQLSLRQNGAH 70

  Fly    55 SCGGSIYSSNVIVTAAHC-LQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIA 118
            .||.|:.|||..::|||| ..:...:.:.:|.||:..::|||.|..:...||..|:.:::..|:.
Mosquito    71 ICGASVISSNYALSAAHCTFPAPPVAAITLRGGSTDRTAGGVVFQTAEIINHPSYSDSSLDFDVC 135

  Fly   119 IIKINGALTFSSTIKAIGLA--SSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCA 181
            :|:|..:.. .:.|..|.||  .::...|....|||||..| ...::|..||.|.|.::||..| 
Mosquito   136 VIRITTSFV-GANIAPITLAPEGTDYPEGTRTMVSGWGATS-AIGALPINLQAVEVPLISQESC- 197

  Fly   182 SSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAA-- 244
            ...:|..| :...|:||:..|:|||.|||||||.:.|..:|:||||......|.|||||.|||  
Mosquito   198 RGVWGAAS-VTDNMVCASEPGRDACGGDSGGPLTNNGRQIGIVSWGSPLCLGNLPGVYARVAAPS 261

  Fly   245 LRSWVISNA 253
            :|:::..||
Mosquito   262 IRAFIRDNA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 87/223 (39%)
AgaP_AGAP006869XP_308888.1 Tryp_SPc 46..259 CDD:214473 84/216 (39%)
Tryp_SPc 47..258 CDD:238113 82/214 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.