DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CLIPA10

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_308802.3 Gene:CLIPA10 / 1270130 VectorBaseID:AGAP006954 Length:1130 Species:Anopheles gambiae


Alignment Length:261 Identity:85/261 - (32%)
Similarity:130/261 - (49%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRI-----VGGSATTISSFPWQISL----QRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQ 82
            ::|||     |.|. :....:|||:::    .:...:.|||::..:..|:|||||:::.:...|:
Mosquito   875 INGRIKNPVYVDGD-SEFGEYPWQVAILKKDPKESVYVCGGTLIDNLYIITAAHCVKTYNGFDLR 938

  Fly    83 IRAGSSYWS-SGGVTF------SVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASS 140
            :|.|.  |. :..|.|      .:.|.:.|..|.|.|:.||:||:|::         :.:.|.|:
Mosquito   939 VRLGE--WDVNHDVEFYPYIERDIISVQVHPEYYAGTLDNDLAILKMD---------RPVDLTSA 992

  Fly   141 ---NPA---------NGAAASVSGWGTLSYGS-SSIPSQLQYVNVNIVSQSQCAS----STYGYG 188
               .||         :|.....:|||..::|. ....:.|:.|:|.||:..||.:    :..||.
Mosquito   993 PHIAPACLPDKHTDFSGQRCWTTGWGKDAFGDYGKYQNILKEVDVPIVNHYQCQNQLRQTRLGYT 1057

  Fly   189 SQIRSTMICAAA-SGKDACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYADVAALRSW 248
            ..:....|||.. .|||||:||.|||||  ..||  :|||||||.||..:|.||||..||....|
Mosquito  1058 YNLNQGFICAGGEEGKDACKGDGGGPLVCERNGVWQVVGVVSWGIGCGQANVPGVYVKVAHYLDW 1122

  Fly   249 V 249
            :
Mosquito  1123 I 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 83/256 (32%)
CLIPA10XP_308802.3 Tryp_SPc 888..1126 CDD:238113 80/248 (32%)
Tryp_SPc 888..1123 CDD:214473 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.