DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CLIPB1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_307756.2 Gene:CLIPB1 / 1269160 VectorBaseID:AGAP003251 Length:372 Species:Anopheles gambiae


Alignment Length:279 Identity:78/279 - (27%)
Similarity:123/279 - (44%) Gaps:75/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQ------RSGSHSCGGSIYSSNVIVTAAHCLQSVSAS--VLQ 82
            |:| |||||..:.|..:||...:|      |.|.| |||.:..:..::|||||::.|.::  |.|
Mosquito   111 QMD-RIVGGGVSPIDGYPWLTRIQYYKGSNRYGFH-CGGVLIHNQYVLTAAHCIEGVPSTWIVYQ 173

  Fly    83 IRAGS------------------------------SYWSSGGVTFSVSSFKNHEGYNANTMVNDI 117
            :|.|.                              .|:...|..:                 |||
Mosquito   174 VRLGEFDTTTTIDCVEDDCADPVRDVLINAYVVHPDYYKQNGADY-----------------NDI 221

  Fly   118 AIIKINGALTFSSTIKAIGLASSNPA-----NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQ 177
            |:::::..:.|:..|:.|.|.:|..:     .|..|:|:|||.....:||  ::..::.|.:|..
Mosquito   222 ALLQLSETVEFTDFIRPICLPTSEESRTVNLTGKYATVAGWGQTENSTSS--TKKLHLRVPVVDN 284

  Fly   178 SQCASSTYGYGSQIRSTMICAAA-SGKDACQGDSGGPLVSGG---------VLVGVVSWGY-GCA 231
            ..||.:......:|..|.:||.. .|||:|:|||||||:..|         .|:|:||:|. .|.
Mosquito   285 EVCADAFSSIRLEIIPTQLCAGGEKGKDSCRGDSGGPLMRYGDGRSSTKSWYLIGLVSFGLEQCG 349

  Fly   232 YSNYPGVYADVAALRSWVI 250
            ....||||..::....||:
Mosquito   350 TDGVPGVYTRMSEYMDWVL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/272 (27%)
CLIPB1XP_307756.2 CLIP 32..85 CDD:288855
Tryp_SPc 114..367 CDD:214473 74/272 (27%)
Tryp_SPc 115..367 CDD:238113 73/271 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.