DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP012670

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_307656.4 Gene:AgaP_AGAP012670 / 1269074 VectorBaseID:AGAP012670 Length:267 Species:Anopheles gambiae


Alignment Length:234 Identity:82/234 - (35%)
Similarity:124/234 - (52%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSA--SVLQIRAGSSYWS 91
            ||||.|.|.:|..:.:.:||:.:|...||.:|.:::..:|||||:....:  |.:.:..||:..|
Mosquito    35 GRIVNGKAVSIVKYKYALSLRVNGVFDCGATIITNSHSLTAAHCVYKYPSDPSRVTLYGGSTSTS 99

  Fly    92 SGGVTFSVSSFKNHEGYNANTMVN----DIAI--IKINGALTFSS--TIKAIGLASSNPANGAAA 148
            |||:...|.|...|..||......    |:|:  :.:|   :||.  .:..:.|.::....|...
Mosquito   100 SGGIEVPVVSIALHPNYNRKGFPAASDCDVAVLTVPVN---SFSGRPNMAPLALQTNELPVGTEC 161

  Fly   149 SVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-ASGKDACQGDSGG 212
            .|.|||...|...:..:||:|.|:||||||.||:    ..::.|..||||. .:|.|.|.|||||
Mosquito   162 FVIGWGRTGYNQPASVNQLRYANMNIVSQSTCAT----IWAEYRKFMICAKYNNGVDTCGGDSGG 222

  Fly   213 PLVSGGVLVGVVSWGYGCAYSNYPGVYADVAA--LRSWV 249
            .||.||.|.||||:.:....|.:|..:|.:.|  :||::
Mosquito   223 ALVCGGGLAGVVSFSHPNCTSAWPAGFAKITAPSIRSFI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 81/231 (35%)
AgaP_AGAP012670XP_307656.4 Tryp_SPc 36..254 CDD:214473 78/224 (35%)
Tryp_SPc 37..263 CDD:238113 80/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.