DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Ctrl

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:271 Identity:93/271 - (34%)
Similarity:139/271 - (51%) Gaps:44/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQL--DGRIVGGSATTISSFPWQISLQ-RSGSHSCGGSIYSS 63
            |..|:|.|:..|.    || .:.|.|  :.|||.|......|:|||:||| .:|.|.||||:.:.
  Rat     8 LSLVLLGSSWGCG----VP-AITPALSYNQRIVNGENAVPGSWPWQVSLQDNTGFHFCGGSLIAP 67

  Fly    64 NVIVTAAHCL--------------QSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMV 114
            |.:||||||.              :|.:|..:|:             .|:|....|..:|.|||.
  Rat    68 NWVVTAAHCKVTPGRHFVILGEYDRSSNAEPIQV-------------LSISKAITHPSWNPNTMN 119

  Fly   115 NDIAIIKINGALTFSSTIKAIGLASSNPA--NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQ 177
            ||:.::|:.....:::.:..:.|||||.|  .|.....:|||.:|...:..|::||.|.:.:|:.
  Rat   120 NDLTLLKLASPARYTAQVSPVCLASSNEALPAGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTV 184

  Fly   178 SQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGV 238
            :||...   :||:|..:||||..:|..:||||||||||    :..||:|:||||........|.:
  Rat   185 NQCRQY---WGSRITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTENCNVQAPAM 246

  Fly   239 YADVAALRSWV 249
            |..|:...:|:
  Rat   247 YTRVSKFNTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 83/239 (35%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 83/239 (35%)
Tryp_SPc 34..260 CDD:238113 83/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.