DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and LOC116412104

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031761512.1 Gene:LOC116412104 / 116412104 -ID:- Length:248 Species:Xenopus tropicalis


Alignment Length:259 Identity:95/259 - (36%)
Similarity:135/259 - (52%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            :|:::..|.:  .|..::|.|  ..:..:||||......|.|:|:|| .:|.|.||||:.|:..:
 Frog     1 MKWLVFFSIL--GLAASLPAG--TDVGDKIVGGHLCPEPSVPYQVSL-NAGYHFCGGSLISTLWV 60

  Fly    67 VTAAHCLQSVSASVL---QIRAGSSYWSSGGVTFSVSSFK--NHEGYNANTMVNDIAIIKINGAL 126
            |:|.||.::....:|   .||.     ..|...| :.|.|  .|..|:...:.|||.::::....
 Frog    61 VSATHCYKARMKVILGEHNIRV-----LEGPEQF-IQSAKVLPHPQYDPRLLDNDIMLVRLAKPA 119

  Fly   127 TFSSTIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            ..:|.::.:.|.:.....|....||||| |||.| .:.|..||.:...|:|..:|..|   |..|
 Frog   120 RINSRVQPVSLPTHCTPVGTDCLVSGWGKTLSNG-VNYPDLLQCLIAPILSDRECQGS---YPGQ 180

  Fly   191 IRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISN 252
            |...|:||.  ..||||||||||||||..|.|.||||||.|||::.|||||..|....:|:..|
 Frog   181 ITENMVCAGYLEGGKDACQGDSGGPLVCNGELQGVVSWGEGCAHAGYPGVYTKVCNYGAWIGHN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 88/226 (39%)
LOC116412104XP_031761512.1 Tryp_SPc 26..241 CDD:238113 88/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.