DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and f7

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_571894.2 Gene:f7 / 114423 ZFINID:ZDB-GENE-010814-1 Length:433 Species:Danio rerio


Alignment Length:264 Identity:81/264 - (30%)
Similarity:116/264 - (43%) Gaps:32/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALGGTVPEGLLP----------QLD--GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            |......|.|.:|          |:|  .||||||.......|||:.|:......|||.||....
Zfish   166 CRSHEVFPCGKVPLLQAGKAADHQVDLRSRIVGGSECPKGHCPWQVLLKYGEKGFCGGVIYKPTW 230

  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSSGGVT---FSVSSFKNHEGYNANTMVNDIAIIKINGALT 127
            |:||||||:.:....|:|.||.........|   ..|.....|..|.:.|..:|||::::...:.
Zfish   231 ILTAAHCLEKLKVKFLRIVAGEHDLEVDEGTEQLIQVDQMFTHPAYVSETADSDIALLRLRTPIV 295

  Fly   128 FSSTIKAIGLASSNPANG-----AAASVSGWGTLSY-GSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            :|.....:.|.....|..     :..:|||||..|. |.:|  ..|:.:.|..:...:|...:  
Zfish   296 YSVYAVPVCLPLREMAERELWAVSKHTVSGWGKRSEDGPTS--RLLRRLLVPRIRTQECVQVS-- 356

  Fly   187 YGSQIRSTMICAA--ASGKDACQGDSGGPLVS----GGVLVGVVSWGYGCAYSNYPGVYADVAAL 245
             ...:.|.|.||.  ...:|:|:||||||||:    ...|:|:||||.|||.....|:|..|:..
Zfish   357 -NLTLTSNMFCAGYIEGRQDSCKGDSGGPLVTRYRDTAFLLGIVSWGKGCARPGSYGIYTRVSNY 420

  Fly   246 RSWV 249
            ..|:
Zfish   421 LQWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/233 (32%)
f7NP_571894.2 GLA 19..82 CDD:214503
EGF_CA 86..121 CDD:238011
FXa_inhibition 131..166 CDD:291342 81/264 (31%)
Tryp_SPc 195..424 CDD:214473 74/233 (32%)
Tryp_SPc 196..427 CDD:238113 74/234 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.