DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP013164

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_003436847.1 Gene:AgaP_AGAP013164 / 11175499 VectorBaseID:AGAP013164 Length:260 Species:Anopheles gambiae


Alignment Length:207 Identity:54/207 - (26%)
Similarity:91/207 - (43%) Gaps:24/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFVILLSAVACALGGTVPEGLLPQLDGRIVGGS-ATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            :.:|.:.:.|||        ..|....|||.|| .:..:.:||...|....|.|..||:.:...|
Mosquito     8 QLIIFICSGACA--------FKPSHGQRIVAGSNVSPHNKYPWIALLTYLDSPSGQGSLINDRTI 64

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFK-----NHEGYNA-NTMVNDIAIIKINGA 125
            ||.|..::|:.. ::.|||....::....:.|::|.:     .|.||.. |...::|.::.:...
Mosquito    65 VTTATIVESMPV-IVHIRALLGVYNRTDASESITSNEISTALAHPGYKTKNQFADNIGLLILKDP 128

  Fly   126 LT-FSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGS 189
            || |......:.:..|.||  ..|:|.|||. ||.:..:...||...:.:.:.|.|.:    ..|
Mosquito   129 LTSFQPICLPVAIPESLPA--PKATVVGWGA-SYPNGPLAEVLQETELQMHAPSICQT----VSS 186

  Fly   190 QIRSTMICAAAS 201
            |:.|..:|..:|
Mosquito   187 QVSSNNLCGESS 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 49/180 (27%)
AgaP_AGAP013164XP_003436847.1 Tryp_SPc 27..248 CDD:214473 49/180 (27%)
Tryp_SPc 28..248 CDD:304450 48/179 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.