DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and KLK11

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:278 Identity:83/278 - (29%)
Similarity:129/278 - (46%) Gaps:48/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            :|||:.....:||          :.||:.|......|.|||.:|.......||.::.:...::||
Human    38 LILLALATGLVGG----------ETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTA 92

  Fly    70 AHCLQS-VSAS----VLQIRAGSSYWSSGGVTFSV--------------------SSFKNHEGYN 109
            ||||:. ||.:    |....:.|:|..|....:.|                    .||. |.|:|
Human    93 AHCLKPWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFP-HPGFN 156

  Fly   110 ANTMV-----NDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQY 169
             |::.     |||.::|:...::.:..::.:.|:|.....|.:..:||||:.|.....:|..|:.
Human   157 -NSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRC 220

  Fly   170 VNVNIVSQSQCASSTYGYGSQIRSTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGYG-CA 231
            .|:.|:...:|.::   |...|..||:||:.  .|||:||||||||||....|.|::|||.. ||
Human   221 ANITIIEHQKCENA---YPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCA 282

  Fly   232 YSNYPGVYADVAALRSWV 249
            .:..||||..|.....|:
Human   283 ITRKPGVYTKVCKYVDWI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 77/251 (31%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 77/251 (31%)
Tryp_SPc 54..303 CDD:238113 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.