DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CORIN

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_006578.2 Gene:CORIN / 10699 HGNCID:19012 Length:1042 Species:Homo sapiens


Alignment Length:242 Identity:76/242 - (31%)
Similarity:121/242 - (50%) Gaps:26/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGS-HSCGGSIYSSNVIVTAAHCLQS-VSASVLQIRAGSS 88
            :::.||:||..:....:|||.|||...| |.||..:.:...::|.|||.:. .:|:|.::..|.:
Human   797 RMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGIN 861

  Fly    89 YWSSGGV---TFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPAN----GA 146
            ......|   |..|.:...|..|:...:..||:|::::..::.:..::.:.|  .||..    ..
Human   862 NLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRPVCL--PNPEQWLEPDT 924

  Fly   147 AASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-ASGK-DACQGD 209
            ...::|||.:   .:.:|.:||...|.|:|...|.|  |.....|.:.||||. .||. |:|.||
Human   925 YCYITGWGHM---GNKMPFKLQEGEVRIISLEHCQS--YFDMKTITTRMICAGYESGTVDSCMGD 984

  Fly   210 SGGPLV---SGG--VLVGVVSWGYGCAYSNY--PGVYADVAALRSWV 249
            ||||||   .||  .|.|:.|||..| :|..  ||||::|:....|:
Human   985 SGGPLVCEKPGGRWTLFGLTSWGSVC-FSKVLGPGVYSNVSYFVEWI 1030

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/236 (32%)
CORINNP_006578.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
DDNN motif 26..29
CRD_corin_1 135..263 CDD:143554
LDLa 269..304 CDD:238060
LDLa 306..340 CDD:238060
Ldl_recept_a 347..377 CDD:278486
LDLa 387..414 CDD:238060
CRD_corin_2 454..575 CDD:143579
LDLa 580..614 CDD:238060
LDLa 655..689 CDD:238060
SR 690..786 CDD:214555
Tryp_SPc 801..1030 CDD:214473 75/236 (32%)
Tryp_SPc 802..1033 CDD:238113 75/237 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.