DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and LOC103908930

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:251 Identity:83/251 - (33%)
Similarity:120/251 - (47%) Gaps:25/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVT 68
            |.:|:..|||:           .:| :|:||.....:|.||||.:...|...||.|:.:.:..|:
Zfish     6 FALLVVNVACS-----------PVD-KIIGGYECPPNSQPWQIYITNDGQRWCGASLINESWAVS 58

  Fly    69 AAHCLQSVSASVLQIRAGSSYWSSGGVT---FSVSSFKNHEGYNANTMVNDIAIIKINGALTFSS 130
            ||||  ::.|::|.:..|.........|   ........|..:...:..|||.:||:.....|:.
Zfish    59 AAHC--NIGANLLTVYLGKHNIDVVEKTEQRIRTEKVFPHPEFKFPSEDNDIMLIKLKDPAVFNQ 121

  Fly   131 TIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTM 195
            .::.|.||:|..:.|....|||||   |....:||.||.:::.:.|:.:|...   |..:....|
Zfish   122 YVQPIPLATSCSSEGEQCLVSGWG---YTEVGLPSVLQCLDLAVQSRQECERV---YKDKFTQNM 180

  Fly   196 ICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :||.  ..||..|.||||||||..|.|.||||||.|||...||.||.:|.....|:
Zfish   181 LCAGFMEGGKGVCHGDSGGPLVCNGELRGVVSWGAGCAEPGYPAVYVEVCRYSDWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 76/223 (34%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 77/224 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.