DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Klk15

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038952112.1 Gene:Klk15 / 102553035 RGDID:1310995 Length:169 Species:Rattus norvegicus


Alignment Length:257 Identity:62/257 - (24%)
Similarity:91/257 - (35%) Gaps:100/257 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDG-RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSN 64
            :|.|::|:||..               || :::.|......|.|||::|...|..:||..:.|.:
  Rat     4 LLAFILLVSAAQ---------------DGDKVLEGEECVPHSQPWQVALFERGRFNCGAFLISPH 53

  Fly    65 VIVTAAHCLQSVSASVLQIRAGS---SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGAL 126
            .::|||||    ....:::|.|.   ..:.......|||....|.||.|.|..:||.::::    
  Rat    54 WVLTAAHC----QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRL---- 110

  Fly   127 TFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
             |.                                  |::|                        
  Rat   111 -FR----------------------------------PARL------------------------ 116

  Fly   192 RSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWVISN 252
                         ..|||||||||.||.|.|:|||| ..|..:..||||..|.:...|:..|
  Rat   117 -------------TPQGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYMDWIRKN 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 53/222 (24%)
Klk15XP_038952112.1 Tryp_SPc 23..165 CDD:238113 54/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.