DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG42694

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:210 Identity:45/210 - (21%)
Similarity:95/210 - (45%) Gaps:19/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SGSH-SCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMV 114
            :|:| .|.||:.|...:::||.|:.......:|:...::..|....|.|.....:|.|   ..:.
  Fly    52 NGTHVLCSGSLISKQFVLSAAQCIDVHGKLFVQLGVSNATKSPHWYTVSNVVIPSHSG---KRLQ 113

  Fly   115 NDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQ 179
            .||.::|::.::.::..:..|.:|.:.........:..:.|.::.|.:  ...|.:.::.:|:.:
  Fly   114 RDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKN--KNPQTIVLSQLSRDR 176

  Fly   180 CASSTYGYGSQIRSTMICAAA-SGKDACQGDSGG----PLVSGG-----VLVGVVSWGYGCAYSN 234
            |..:..|   .:....||||: ...::|..|||.    |::.|.     :|.|:..:..|.::.:
  Fly   177 CKLNLSG---NVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCS 238

  Fly   235 YPGVYADVAALRSWV 249
            .|.:|.|||....|:
  Fly   239 EPAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 44/208 (21%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 45/210 (21%)
Tryp_SPc 46..253 CDD:214473 44/208 (21%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.