DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and LOC101732176

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:264 Identity:102/264 - (38%)
Similarity:144/264 - (54%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQR---SGSHSCGGSIYSSNVI 66
            ::.|..:.|        ||..::|.|||||:......:||||||.:   :..:.|||||.:...|
 Frog   259 MVSLRCINC--------GLSTKVDNRIVGGTFALAGDWPWQISLMKLVGTSLYLCGGSIITPYWI 315

  Fly    67 VTAAHCL--QSVSASVLQIRAG----SSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGA 125
            ||||||:  .:.|.|:.::.||    |:|:|:|   :.|.....|..|:.||...|||::|:..|
 Frog   316 VTAAHCVYGYTSSPSIFKVFAGSLTLSNYYSAG---YLVDRVLIHPSYSPNTQNYDIALLKLKTA 377

  Fly   126 LTFSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYG 188
            |.||:.::.:.|.:...  |:|....:|||||.| .:.||.:.|:..:|.|:|.:.|..:.. ||
 Frog   378 LVFSTNLRPVCLPNVGMPWADGQPCWISGWGTTS-EAGSISTSLKAASVPIISSATCNLAPV-YG 440

  Fly   189 SQIRSTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRS 247
            ..|..|||||.  ..|.|.||||||||||    |...|||..|||||||.:..||||.::.....
 Frog   441 GVISPTMICAGYLGGGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAYKPGVYGNITVFLE 505

  Fly   248 WVIS 251
            |:.|
 Frog   506 WIYS 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 95/235 (40%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 4/19 (21%)
Tryp_SPc 277..510 CDD:238113 96/238 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.