DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and tmprss2.1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_004912265.1 Gene:tmprss2.1 / 101731874 XenbaseID:XB-GENE-22065907 Length:482 Species:Xenopus tropicalis


Alignment Length:256 Identity:98/256 - (38%)
Similarity:141/256 - (55%) Gaps:21/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            |:.|..:.|  |.:.     ..:..||||||..::..:|||:|||.:..|.|||||.:.|.|:||
 Frog   229 VVTLRCIEC--GSST-----KNVGNRIVGGSQASLGDWPWQVSLQFNERHICGGSIITPNYILTA 286

  Fly    70 AHCLQSVSASVL--QIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTI 132
            |||::.|.:|..  .:..||.|.|:||..:||.|...|:.|:..|..||||::::...:|.:||:
 Frog   287 AHCVEGVYSSPYPWTVYVGSLYKSTGGTRYSVKSLIGHQNYDTKTKNNDIALMRLKSPITLTSTV 351

  Fly   133 KAIGLASSNP--ANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRST 194
            :.:.|.::..  .:|.:...|||| |:..|:||  ..|....|.::....|..:.. |...:.:|
 Frog   352 QPVCLPNAGMLWTSGQSCWTSGWGATIEGGTSS--GVLNAAMVPLIDSDTCNRAVV-YNGAVTAT 413

  Fly   195 MICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||||.  ..|.|:||||||||||    |...|||..|||.|||..|.||||.::..|..|:
 Frog   414 MICAGYLRGGIDSCQGDSGGPLVTKTSSLWWLVGDTSWGTGCANMNKPGVYGNITELLPWI 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 93/229 (41%)
tmprss2.1XP_004912265.1 LDLa 112..143 CDD:238060
SRCR_2 148..241 CDD:373897 4/13 (31%)
Tryp_SPc 248..474 CDD:238113 92/228 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.