DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and prss56

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:235 Identity:82/235 - (34%)
Similarity:117/235 - (49%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSY---- 89
            |||||||.|:..|:||.::::.:|...|||.:.....|:|||||.......||.......|    
 Frog    73 GRIVGGSITSPGSWPWLVNIRFNGELMCGGVLLDDMWILTAAHCFTGSVNEVLWTVVVGQYDLTK 137

  Fly    90 WSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL--ASSNPANGAAASVSG 152
            .:.|..||.|:....|..:|..|..||:|::::..::|.|.:.:.:.|  ...:|..|....::|
 Frog   138 NAQGEKTFQVNRIVTHPKFNQKTFDNDLALLELTSSVTASQSARPVCLPPVPRDPTPGTNCYIAG 202

  Fly   153 WGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLV 215
            ||:| |....:...:....|.::||..| .||.| .:.:.|||.||.  ..|.|:|||||||||.
 Frog   203 WGSL-YEDGPLSDVIMEARVPVLSQEAC-RSTLG-KNMLTSTMFCAGYLNGGIDSCQGDSGGPLT 264

  Fly   216 SGG------VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ...      ||.|:.|||.||.....||||..|.|...|:
 Frog   265 CQDPISKQYVLYGITSWGDGCGERGKPGVYTRVTAFTDWI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 80/232 (34%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.