DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and LOC101730924

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:257 Identity:105/257 - (40%)
Similarity:147/257 - (57%) Gaps:27/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            :|...:||.|.|..            .|.:|:||:....:|.|:.:|| .||.|.||||:.::..
 Frog     3 LLLLCVLLGAAAAF------------DDDKIIGGATCAKNSVPYIVSL-NSGYHFCGGSLINNQW 54

  Fly    66 IVTAAHCLQSVSASVLQIRAGS-SYWSSGGVTFSVSSFK--NHEGYNANTMVNDIAIIKINGALT 127
            :|:||||.:   ||: |:|.|. :...|.|....:||.|  .|.|||:.|:.|||.:||::.|.:
 Frog    55 VVSAAHCYK---ASI-QVRLGEHNIALSEGTEQFISSSKVIRHSGYNSWTLDNDIMLIKLSSAAS 115

  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            .::.:.|:.|.|...|.|.:..:|||| |||.| |:.|..||.:...|::.:||.::   |..:|
 Frog   116 LNAAVNAVALPSGCAAAGTSCLISGWGNTLSSG-SNYPDLLQCLYAPILTDAQCNNA---YPGEI 176

  Fly   192 RSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            .:.|||..  ..|||:||||||||:|..|.|.||||||||||..||||||..|....||:.|
 Frog   177 TNNMICLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 97/224 (43%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 99/227 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.