DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and tmprss2.12

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:260 Identity:100/260 - (38%)
Similarity:141/260 - (54%) Gaps:28/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            |:.|..:.|        ||....:.||||||:.:|..:|||::||...::.||||:.::|.||||
 Frog   243 VVSLKCIDC--------GLSTYGESRIVGGSSASIGDWPWQVNLQYDDTNLCGGSVIAANWIVTA 299

  Fly    70 AHCLQSVSAS-------VLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALT 127
            |||:|..::|       :.:|:..|.|.||   .:||.....|..|::.|..||||::|:..::.
 Frog   300 AHCVQGDTSSPSLWKAFIGKIKMPSYYDSS---AYSVDRIIVHPDYSSQTNSNDIALMKLKTSIA 361

  Fly   128 FSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            |||..:.:.|.:...  ..|....:|||||.|. ..||.|.|:|..|.::|.:.| :.|..|...
 Frog   362 FSSISRPVCLPNYGMQWEEGQPCYISGWGTTSQ-KGSISSVLKYAMVPLISPTTC-NQTIMYNGA 424

  Fly   191 IRSTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |.|:||||.  ..|.|:||||||||||    |...|||..|||.|||....||||.::.....|:
 Frog   425 ITSSMICAGYPKGGVDSCQGDSGGPLVTKTNSLWWLVGDTSWGDGCANVYRPGVYGNMTVFLQWI 489

  Fly   250  249
             Frog   490  489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 94/233 (40%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055 5/19 (26%)
Tryp_SPc 261..489 CDD:238113 93/232 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.