DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and f12

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:249 Identity:94/249 - (37%)
Similarity:130/249 - (52%) Gaps:27/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL-QSVSASVLQIRAGSS 88
            |.:..|||||.....:|.|: |:.....:|.||||:.|...|||||||| |..:.:.:.:..|.|
 Frog   353 PSIMPRIVGGLVALPASHPY-IAALYIDNHFCGGSLISPCWIVTAAHCLDQRPNVTKISVVLGQS 416

  Fly    89 YWSSGG---VTFSVSSFKNHEGYNANTMVNDIAIIK---ING--ALTFSSTIKAIGLASSNPANG 145
            .:::..   ||..|..:..||.|..:|:.:|||::|   |||  |..||..::.|.|    |...
 Frog   417 RFNTTDQHTVTLLVEKYILHEKYYGDTLQHDIALVKVKSINGLCASEFSQFVQPICL----PQQF 477

  Fly   146 AAAS------VSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASG 202
            ..|.      |:|||....|:......||..::.|:..:||.|.:. :|.::...|:||.  ..|
 Frog   478 KMAESTKQCVVAGWGHQYEGAEHYAFFLQEASMPIIPYTQCQSPSV-HGDRMLPGMLCAGFMEGG 541

  Fly   203 KDACQGDSGGPL---VSGGV-LVGVVSWGYGCAYSNYPGVYADVAALRSWVISN 252
            .|||||||||||   |.|.: |.||||||.|||..|.||||..|.:...|:.:|
 Frog   542 VDACQGDSGGPLVCEVDGRIELHGVVSWGSGCAEENKPGVYTAVTSYTDWIRAN 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 91/239 (38%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 91/241 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.