DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and tmprss6

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:245 Identity:86/245 - (35%)
Similarity:123/245 - (50%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWS--S 92
            |:|||:......:|||.|||..|.|.|||::.:...|:|||||....|      .|....|:  .
 Frog   570 RLVGGTQAQEGEWPWQASLQVRGEHICGGTLVADQWILTAAHCFTPES------YASPEVWTVYL 628

  Fly    93 GGVTFSVSSFKN----------HEGYNANTMVNDIAIIKINGALTFSST-IKAIGLASSNP--AN 144
            |.|..|.|:.|.          |..|:.::...|:|::.::..:..:|. ::.|.|.||..  ..
 Frog   629 GKVRLSRSTQKELAFKVIRLVIHPFYDEDSHDYDVALVLLDHLVPLTSPHVQPICLPSSTHHFPT 693

  Fly   145 GAAASVSGWGTL-SYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDAC 206
            |::..|:|||:: ..|.:|  ..||.|::.:|:|..| :..|.|  ||...|:||.  ...||||
 Frog   694 GSSCWVTGWGSVKENGPTS--DVLQKVDIQLVAQDIC-TELYRY--QISPRMLCAGYRDGSKDAC 753

  Fly   207 QGDSGGPLV----SG-GVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            |||||.|||    || ....|:||||.||....|.|||:.:..|..|:.|
 Frog   754 QGDSGSPLVCKTASGRWFQAGLVSWGAGCGIPRYFGVYSRITRLVQWIES 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 84/241 (35%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060
LDLa 525..560 CDD:238060
Tryp_SPc 572..804 CDD:238113 85/243 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.