DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Gm10334

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:250 Identity:93/250 - (37%)
Similarity:138/250 - (55%) Gaps:21/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAA 70
            ::|:.|..|:...|.:      |.:||||.....:|.|:|:|| .||.|.||||:.:...:|:||
Mouse     5 LILALVGAAVAFPVDD------DDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAA 62

  Fly    71 HCLQSVSASVLQIRAGSSYWS--SGGVTF-SVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTI 132
            ||.:    :.:|:|.|....:  .|...| :.:....|..:|..|:.|||.:||::..:|.::.:
Mouse    63 HCYK----TRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARV 123

  Fly   133 KAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMI 196
            ..:.|.||....|....:|||| |||:|.|. |..||.::..::.|:.|.:|   |..:|...|:
Mouse   124 ATVALPSSCAPAGTQCLISGWGNTLSFGVSE-PDLLQCLDAPLLPQADCEAS---YPGKITGNMV 184

  Fly   197 CAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||.  ..|||:||||||||:|..|.|.|:||||||||..:.||||..|.....|:
Mouse   185 CAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 87/224 (39%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 88/224 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.