DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and f7l

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:263 Identity:87/263 - (33%)
Similarity:126/263 - (47%) Gaps:49/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASV 80
            |..|.:|:.|    |||.|........|||..|:..|.:.|||.|.:|..|:|||||:.....::
Zfish   184 GRPVAKGVGP----RIVKGDVCPKGQCPWQALLEYDGQYKCGGVILNSQWIITAAHCIWRKDPAL 244

  Fly    81 LQIRAGSSYWSSGGVT---FSVSSFKNHEGYNANTMVNDIAIIKI------------------NG 124
            ||:..|.........|   ..||....|..||.::..:|:|::::                  ||
Zfish   245 LQVIVGEHIRDRDEGTEQMRKVSEVFLHPQYNHSSTDSDVALLRLHRPVTLGPYALPVCLPPPNG 309

  Fly   125 ALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQ-LQYVNVNIVSQSQCASSTYGYG 188
              |||.|:.:|.:          ::|||||.|:  .|..||. ||.:.|..||...|.:.:   |
Zfish   310 --TFSRTLASIRM----------STVSGWGRLA--QSGPPSTVLQRLQVPRVSSEDCRARS---G 357

  Fly   189 SQIRSTMICA--AASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRS 247
            ..:...|:||  |..|:|:||||||||||    :...|.|:||||.|||.::..|:|..|:....
Zfish   358 LTVSRNMLCAGFAEGGRDSCQGDSGGPLVTRYRNTWFLTGIVSWGKGCARADVYGIYTRVSVFVE 422

  Fly   248 WVI 250
            |::
Zfish   423 WIL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 82/246 (33%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.