DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and plaua

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:247 Identity:75/247 - (30%)
Similarity:114/247 - (46%) Gaps:34/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGG 94
            :|:||..:|:.|.||..::.:.....|||::.:...::|||||..:...:  ||...|.......
Zfish   163 KIIGGLRSTVESQPWMAAIFKGDGFICGGTLITPCWVLTAAHCFPTGKRT--QINRYSVVLGKNA 225

  Fly    95 VT---------FSVSSFKNHE--GYNANTMVNDIAIIKI---NGALTFSSTIKAIGLASSNPAN- 144
            :.         |:||....||  .|:.....:|||::||   ||.....:  |.:..|...|.. 
Zfish   226 INETDPVKEQKFTVSRLVIHEDFDYSTENYTHDIALLKIEDCNGQCAVKT--KTVRTACLPPFQQ 288

  Fly   145 ----GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGK-- 203
                |....::|:|....|:......|:...|.::||..| ..||....::...|:|  |:|:  
Zfish   289 MLPVGFYCEIAGYGRYQKGTFKFSRYLKQTEVKLISQKVC-QRTYYNKDEVNENMLC--ANGRDW 350

  Fly   204 --DACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
              ||||||||||||    :...|.|::|||..||..|.||||..|:....|:
Zfish   351 KTDACQGDSGGPLVCEVNNIMFLFGIISWGKECAEKNQPGVYTQVSNYNQWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/245 (30%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.