DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and tmprss3a

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:266 Identity:93/266 - (34%)
Similarity:125/266 - (46%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            |..|..|..:||        |..|:...|||||:.:....||||:||.....|.|||||.:|..|
Zfish   277 LGMVTALKCIAC--------GSRPKFSARIVGGNLSAEGQFPWQVSLHFQNEHLCGGSIITSRWI 333

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWS-SGGVT---------FSVSSFKNHEGYNANTMVNDIAIIK 121
            :|||||:..:        |...||. ..|:|         |:|.....|..|....:.:|||::|
Zfish   334 LTAAHCVYGI--------AYPMYWMVYAGLTELPLNAVKAFAVEKIIYHSRYRPKGLDHDIALMK 390

  Fly   122 INGALTFSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASST 184
            :...|||:..::.|.|.:...  .:|....:||||....|..:..|| ...:|.::|...| |..
Zfish   391 LAQPLTFNGMVEPICLPNFGEQFEDGKMCWISGWGATEDGGDASVSQ-HCASVPLISNKAC-SQP 453

  Fly   185 YGYGSQIRSTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVA 243
            ..|...:.:.||||.  ..|.|:|||||||||.    |...|||..|||.|||..|.||||..:.
Zfish   454 EVYQGYLTAGMICAGYLDGGTDSCQGDSGGPLACEDSSIWKLVGATSWGQGCAEKNKPGVYTRIT 518

  Fly   244 ALRSWV 249
            ...:|:
Zfish   519 QSLTWI 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 85/236 (36%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 6/22 (27%)
Tryp_SPc 298..525 CDD:238113 85/237 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.