DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ING2 and Ing5

DIOPT Version :9

Sequence 1:NP_001555.1 Gene:ING2 / 3622 HGNCID:6063 Length:280 Species:Homo sapiens
Sequence 2:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster


Alignment Length:279 Identity:94/279 - (33%)
Similarity:150/279 - (53%) Gaps:41/279 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    27 YVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEID----DVYEKYKKEDDLNQKKR--LQQL 85
            |:::||:.:||||.:::||..::|:||::.|..:|.||    |...|..:...:::.:|  .|:.
  Fly     6 YLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQED 70

Human    86 LQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCF----QDPAESERASDK---AKMDSS 143
            ::.....::|..|:|:|:..|..|||:.:.|:::.....|    |:.|.|.||..:   ||....
  Fly    71 IKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRK 135

Human   144 QPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQERE--------- 199
            :.:.|....::::::.|.:.....|...:.:........:....|||:||..||:|         
  Fly   136 KTKDSKTTGKKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKETRKGGAQKK 200

Human   200 -------------------ASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSL 245
                               :..::..:||||||||||:||||||||||||..||||||||:||.|
  Fly   201 TVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGL 265

Human   246 TYKPKGKWYCPKCRGDNEK 264
            |.||||||:||||..|.:|
  Fly   266 TTKPKGKWFCPKCTQDRKK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ING2NP_001555.1 ING_ING2 32..119 CDD:341094 27/92 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..204 19/116 (16%)
PHD_ING2 213..261 CDD:277153 39/47 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280 3/7 (43%)
PBR. /evidence=ECO:0000269|PubMed:16728974 264..280 1/1 (100%)
Ing5NP_609647.1 TNG2 1..278 CDD:227367 90/271 (33%)
ING 6..108 CDD:289749 29/101 (29%)
PHD_ING4_5 234..278 CDD:277061 36/43 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.