DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and prss60.1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:263 Identity:95/263 - (36%)
Similarity:133/263 - (50%) Gaps:19/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTK-SGSHFCGGSLINE 68
            :.||:|:....:.....|::   |.  ..|||||.:...|:.|:||||.:. .|.|||||||||.
Zfish     9 LALLLCVQGSHSQLNVCGLA---PL--NNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINS 68

  Fly    69 DTVVTAAHCLVGRKVSKVFVRLGSTL---YNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEK 130
            :.|:||||||.....|.:.|.||.|.   .|...|...|..:..:..||:.|.|.|:.:|.|...
Zfish    69 EWVLTAAHCLPRITTSSLLVFLGKTTQQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLSSA 133

  Fly   131 VKETENIRYIELATETP--PTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKY 193
            |..:..||.:.||.:..  |.||::.:||||:......:..|..|||..:.:|....|  :....
Zfish   134 VTFSNYIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQC--NALLG 196

  Fly   194 GEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLV----GIVSWGYACASNLLPGVYSDVPALR 252
            ...:.::|:||  .:..:|.||||||||:.....||    ||.||||.||....||||:.|...:
Zfish   197 SGSVTNNMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQ 261

  Fly   253 KWI 255
            .||
Zfish   262 SWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 88/232 (38%)
Tryp_SPc 35..255 CDD:238113 87/231 (38%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 88/232 (38%)
Tryp_SPc 34..267 CDD:238113 89/233 (38%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.