DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Prss44

DIOPT Version :10

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:267 Identity:92/267 - (34%)
Similarity:131/267 - (49%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLV 79
            |||.           .|..|||||........|:|||||... .|.||||||::..|:|||||:.
Mouse   103 SACG-----------HRTARIVGGRPAPARKWPWQVSLQVHK-QHICGGSLISKWWVITAAHCVY 155

  Fly    80 GRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYN-SKTMEYDVGILKLDEKVKETENIRYI--- 140
            |.....||:. .:.|:::..:.:.|:::..::|:: .:|:.:|:.::.|...|..:.||:.:   
Mouse   156 GHLDYAVFMG-DADLWSKRPVRIPVQDIIVHQDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIP 219

  Fly   141 ELATETPPTGTTAVVTGWGSKCYFWCMTL-----PKTLQEVYVNIVDWKTCASDEYKYGEIIYDS 200
            |.:....| ||...|||||.       .|     .:.|||:.:||:..:.|       .:|:.|.
Mouse   220 EKSFLVQP-GTLCWVTGWGK-------VLEQGRSSRILQEIELNIIRHEKC-------NQILKDI 269

  Fly   201 M-----------VCAY-EKKKDACQGDSGGPLA--VGNT--LVGIVSWGYACASNLLPGVYSDVP 249
            |           ||.| ||..|||||||||||.  ...|  .|||||||..|.....||||::|.
Mouse   270 MGNIFTLVQEGGVCGYNEKGGDACQGDSGGPLVCEFNKTWVQVGIVSWGLGCGRIGYPGVYTEVS 334

  Fly   250 ALRKWIL 256
            ..|.||:
Mouse   335 YYRDWII 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 86/245 (35%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 112..340 CDD:238113 85/244 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.