DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Klk12

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:260 Identity:84/260 - (32%)
Similarity:126/260 - (48%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHF-CGGSLINE 68
            ::||:|         .||:|..|   || :|..|.:....:.|:||.|  ..|.:. |||.|::.
Mouse     5 ILLLLC---------AVGLSQAD---RE-KIYNGVECVKNSQPWQVGL--FHGKYLRCGGVLVDR 54

  Fly    69 DTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNS-----KTMEYDVGILKLD 128
            ..|:|||||.     .|..||||.....:......:|...::..:.|     :..|:|:.:|:|:
Mouse    55 KWVLTAAHCR-----DKYVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQGAYQNHEHDLRLLRLN 114

  Fly   129 EKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKY 193
            ..:..|..:|.:.|.:....||....|:|||:....| ...|..||.:.::.|..:||.:   .:
Mouse   115 RPIHLTRAVRPVALPSSCVTTGAMCHVSGWGTTNKPW-DPFPDRLQCLNLSTVSNETCRA---VF 175

  Fly   194 GEIIYDSMVCA-YEKKKDACQGDSGGPLAVGNTLVGIVSWGYA--CASNLLPGVYSDVPALRKWI 255
            ...:.::|:|| .|..||||||||||||..|..|.|:||||..  |....:||||:.|.....||
Mouse   176 PGRVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

  Fly   256  255
            Mouse   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 73/229 (32%)
Tryp_SPc 35..255 CDD:238113 73/228 (32%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 73/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.