DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and LOC683849

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:254 Identity:98/254 - (38%)
Similarity:133/254 - (52%) Gaps:23/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTV 71
            ||:...||:|.|        .|.:.:.:||||......:.||||||  .||.|||||||||:..|
  Rat     4 LLILALVGTAVA--------FPVDDDDKIVGGYTCQENSVPYQVSL--NSGYHFCGGSLINDQWV 58

  Fly    72 VTAAHCLVGRKVSKVFVRLGSTLYN--EGG-IVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKE 133
            |:||||.    .|::.||||....|  ||. ..|...::..:.:::.||:..|:.::||...||.
  Rat    59 VSAAHCY----KSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKL 119

  Fly   134 TENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIY 198
            ...:..:.|.:...|.||..:::|||:...|. :..|..||.:...::....|   |..|...|.
  Rat   120 NARVATVALPSSCAPAGTQCLISGWGNTLSFG-VNEPDLLQCLDAPLLPQADC---EASYPGKIT 180

  Fly   199 DSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            |:||||  .|..||:||||||||:.....|.|||||||.||....||||:.|.....||
  Rat   181 DNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 89/225 (40%)
Tryp_SPc 35..255 CDD:238113 89/224 (40%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 89/225 (40%)
Tryp_SPc 24..242 CDD:238113 91/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.