DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:237 Identity:89/237 - (37%)
Similarity:118/237 - (49%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYN 96
            :.:||||......|.||||||  .||.|||||||||...||:||||.    .|::.||||.  :|
Mouse    22 DDKIVGGYTCQRNALPYQVSL--NSGYHFCGGSLINSQWVVSAAHCY----KSRIQVRLGE--HN 78

  Fly    97 ----EGG-IVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVT 156
                ||| ..:...::..:.:||:.|...|:.::||.........:..:.|....|..||..:|:
Mouse    79 IDALEGGEQFIDAAKIIRHPNYNANTYNNDIMLIKLKTAATLNSRVSTVALPRSCPSAGTRCLVS 143

  Fly   157 GWGSKCYFWCMTL------PKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCA--YEKKKDACQ 213
            |||:       ||      |..||.:...::...:|.|   .|...|..:|.|.  .|..||:||
Mouse   144 GWGN-------TLSSGTNYPSLLQCLDAPVLSDSSCTS---SYPGKITSNMFCLGFLEGGKDSCQ 198

  Fly   214 GDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            ||||||:.....|.|:|||||.||....||||:.|.....||
Mouse   199 GDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 87/233 (37%)
Tryp_SPc 35..255 CDD:238113 87/232 (38%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 87/233 (37%)
Tryp_SPc 25..243 CDD:238113 89/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.