DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and prss1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:270 Identity:97/270 - (35%)
Similarity:131/270 - (48%) Gaps:50/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDT 70
            :||...||  |.|..:|       :.:.:||||.:.|....||||||  .||.||||||||:...
Zfish     5 ILLALFAV--AYAAPLG-------DDDDKIVGGYECTKNGVPYQVSL--NSGYHFCGGSLISNLW 58

  Fly    71 VVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVA--------VRELAYNEDYNSKTMEYDVGILKL 127
            ||:||||.    .|:|.||||     |..|.|.        ..::..:..|||.|::.||.::||
Zfish    59 VVSAAHCY----KSRVQVRLG-----EHNIDVTEGTEQFINSEKVIRHPSYNSNTLDNDVMLIKL 114

  Fly   128 DEKVKETENIRYIELATETPPTGTTAVVTGWGS--------KCYFWCMTLPKTLQEVYVNIVDWK 184
            ....:....::.:.|.:....:||:.:::|||:        .....|:..|         |:...
Zfish   115 SSSAQINSYVKTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAP---------ILSDS 170

  Fly   185 TCASDEYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSD 247
            ||.:   .|...|..:|.||  .|..||:||||||||:...|.|.|||||||.||....||||:.
Zfish   171 TCRN---AYPGQISSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAK 232

  Fly   248 VPALRKWILN 257
            |.....||.|
Zfish   233 VCNFTTWIRN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 87/238 (37%)
Tryp_SPc 35..255 CDD:238113 87/237 (37%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 87/238 (37%)
Tryp_SPc 25..243 CDD:238113 90/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.