DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG17234

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:266 Identity:93/266 - (34%)
Similarity:133/266 - (50%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVV 72
            |:.||:....||.|.       ..|.||:|||...|...|:||||| ..|.|.||||:.:|:.:|
  Fly     7 LLLLALDFLSAGQVN-------RWEQRIIGGEPIGIEQVPWQVSLQ-YFGDHVCGGSIYSENIIV 63

  Fly    73 TAAHCLVGRKVSKV-----FVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVK 132
            |||||....:.:::     .||.||.|.:..|.:|.|..|..:|:|.......|:.|::|...::
  Fly    64 TAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLE 128

  Fly   133 ETENIRYIELATETPPTGTTAVVTGWG--------SKCYFWCMTLPKTLQEVYVNIVDWKTCASD 189
            .|..::.|.||...|...:.|:|:|||        :..|      |..||.:.::|....:|.  
  Fly   129 FTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLY------PTHLQGLALHIKSIFSCR-- 185

  Fly   190 EYKYGEIIYD-SMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWG-YACASNLLPGVYSDVPALR 252
                   ::| |::||....:.||.|||||||.|...|||:|||| ..|.|:   ..:..||..|
  Fly   186 -------LFDPSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSS---AFFVSVPYFR 240

  Fly   253 KWILNA 258
            :|||||
  Fly   241 EWILNA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 81/235 (34%)
Tryp_SPc 35..255 CDD:238113 80/234 (34%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 81/235 (34%)
Tryp_SPc 27..243 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452473
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27101
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.