DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and CG34458

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:260 Identity:88/260 - (33%)
Similarity:135/260 - (51%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65
            ::.||.|.:.|     .|.|...|:.|..| |.||:||:....|..|:|||||. :|.|.|||||
  Fly     4 VNNLVKLSILL-----LAVTFVHSDMDVAE-ESRIIGGQFAAPGQFPHQVSLQL-NGRHHCGGSL 61

  Fly    66 INEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEG-GIVVAVRELAYNEDYNSKTMEYDVGILKLDE 129
            |::..:||||||.:|:...::...:|:...:.| |....:.:...:..||.::.::|:.::||..
  Fly    62 ISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSS 126

  Fly   130 KVKETENIRYIELATETP--PTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYK 192
            .|.....::.|:||....  ...|.|:::|:|:  ....:.||..|:...|.:.....|.|....
  Fly   127 PVPMGGAVQTIQLADSDSNYAADTMAMISGFGA--INQNLQLPNRLKFAQVQLWSRDYCNSQNIP 189

  Fly   193 YGEIIYDSMVCAYEK--KKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            .   :.|.||||...  :..:|||||||||.|...|.|:||||:.|.:...|.:|:.|.|||.||
  Fly   190 G---LTDRMVCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWI 251

  Fly   256  255
              Fly   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 76/225 (34%)
Tryp_SPc 35..255 CDD:238113 75/224 (33%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 76/225 (34%)
Tryp_SPc 32..254 CDD:238113 77/226 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452411
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.