DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and AZU1

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:271 Identity:70/271 - (25%)
Similarity:113/271 - (41%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHRLVVL-LVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGS 64
            |.||.|| |:...:.|:.||:..:.:         ||||........|:..|:|.: |.|||||:
Human     1 MTRLTVLALLAGLLASSRAGSSPLLD---------IVGGRKARPRQFPFLASIQNQ-GRHFCGGA 55

  Fly    65 LINEDTVVTAAHCLVGRKVSKVFVRLGSTLYN---------EGGIVVAVRELAYNEDYNSKTMEY 120
            ||:...|:|||.|...:......|.||:  |:         :...:.::.|..|:...|..    
Human    56 LIHARFVMTAASCFQSQNPGVSTVVLGA--YDLRRRERQSRQTFSISSMSENGYDPQQNLN---- 114

  Fly   121 DVGILKLDEKVKETENIRYIELATE--TPPTGTTAVVTGWGSKCYFWCMT-LPKTLQEVYVNIVD 182
            |:.:|:||.:...|.::..:.|..:  |...||...|.||||:.....:: .|:     :||:. 
Human   115 DLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPR-----FVNVT- 173

  Fly   183 WKTCASDEYKYGEIIYDSMVC--AYEKKKDACQGDSGGPLAVGNTLVGIVSWGYA-CASNLLPGV 244
              ....|:.:      .:.||  ...::...|.||.|.||.......|:.|:... |...  |..
Human   174 --VTPEDQCR------PNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRG--PDF 228

  Fly   245 YSDVPALRKWI 255
            ::.|...|.||
Human   229 FTRVALFRDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 59/235 (25%)
Tryp_SPc 35..255 CDD:238113 59/234 (25%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 61/236 (26%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 13/24 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.