DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and KLK10

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:267 Identity:75/267 - (28%)
Similarity:109/267 - (40%) Gaps:67/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAH 76
            |.||.||.                        |:.|:||||......| |.|.|:::..|:||||
Human    47 AYGSPCAR------------------------GSQPWQVSLFNGLSFH-CAGVLVDQSWVLTAAH 86

  Fly    77 C----------------LVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGIL 125
            |                |.|.::.:....:....|::|...:..|          :|.|:|:.:|
Human    87 CGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPR----------RTDEHDLMLL 141

  Fly   126 KLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKC-----YFWCMTLPKTLQEVYVNIVDWKT 185
            ||...|.....:|.::|.......|....|.|||:..     |      .|.|....:.|:..|.
Human   142 KLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKY------NKGLTCSSITILSPKE 200

  Fly   186 CASDEYKYGEIIYDSMVCA-YEKKKDACQGDSGGPLAVGNTLVGIVSWG-YACASNLLPGVYSDV 248
            |   |..|..::.::|:|| .::.:|.||.||||||....||.||:||| |.|.|...|.||:.:
Human   201 C---EVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQI 262

  Fly   249 PALRKWI 255
            .....||
Human   263 CKYMSWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 68/243 (28%)
Tryp_SPc 35..255 CDD:238113 68/242 (28%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 74/265 (28%)
Tryp_SPc 49..269 CDD:214473 72/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.