DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and Klk11

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:264 Identity:85/264 - (32%)
Similarity:129/264 - (48%) Gaps:32/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLIN 67
            |:::.|:.||:   ..|.||        .|.||:.|.:....:.|:||:|..|: ...||.:||.
Mouse    27 RMILRLIALAL---VTGHVG--------GETRIIKGYECRPHSQPWQVALFQKT-RLLCGATLIA 79

  Fly    68 EDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELA--------YNEDYNSKTMEYDVGI 124
            ...::|||||   ||...|.:.....|....|  ...|.:|        :|....:|....|:.:
Mouse    80 PKWLLTAAHC---RKPHYVILLGEHNLEKTDG--CEQRRMATESFPHPDFNNSLPNKDHRNDIML 139

  Fly   125 LKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASD 189
            :|:...|..|..::.:.|:......||:.:::|||:..... :.||.:|:...|:|::.|.|   
Mouse   140 VKMSSPVFFTRAVQPLTLSPHCVAAGTSCLISGWGTTSSPQ-LRLPHSLRCANVSIIEHKEC--- 200

  Fly   190 EYKYGEIIYDSMVCAYEKK--KDACQGDSGGPLAVGNTLVGIVSWGY-ACASNLLPGVYSDVPAL 251
            |..|...|.|:|:||..:|  ||:|||||||||....:|.||:|||. .||....||||:.|...
Mouse   201 EKAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKY 265

  Fly   252 RKWI 255
            ..||
Mouse   266 FNWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 75/231 (32%)
Tryp_SPc 35..255 CDD:238113 74/230 (32%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 75/231 (32%)
Tryp_SPc 48..272 CDD:238113 76/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.