DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thetaTry and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:166 Identity:57/166 - (34%)
Similarity:75/166 - (45%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 YNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAV------VTGWGSKCYFWCMTLPK 171
            ||..|...|:.::||...:   |..||:.|| ..|...|..:      |:||||..:...: :|.
Zfish    34 YNRSTNNADIMLIKLSAPI---ELNRYVSLA-PLPKQNTGLLAGRMCRVSGWGSTSHSGGL-IPL 93

  Fly   172 TLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCAYEKK--KDA---------------CQGDSGGP 219
            ||:.|.:.||....|.|.....|.|. .:|:||....  |||               ||||||||
Zfish    94 TLRTVRLPIVSTFKCNSSSSFSGNIT-ANMICAGSSTGGKDACKNSTQYLCHLIVYLCQGDSGGP 157

  Fly   220 LAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWI 255
            |.....:.|:||||..|.....||||:.|...|:||
Zfish   158 LVCDGRVYGLVSWGNGCGDPRFPGVYTAVSRFRRWI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 55/164 (34%)
Tryp_SPc 35..255 CDD:238113 55/164 (34%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 57/166 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.